PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0207s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 326aa    MW: 36147.6 Da    PI: 8.6512
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0207s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.5e-55141421129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL kkv +++++  ++i+evd++k+ePw+Lp k+k  ekewyfFs rd+ky+tg r+nrat++gyWkatg
  SapurV1A.0207s0120.1.p  14 LPPGFRFHPTDEELITYYLLKKVLDRNFTG-RAIAEVDLNKCEPWELPGKAKMVEKEWYFFSLRDRKYPTGLRTNRATEAGYWKATG 99 
                             79*************************999.89***************9888999******************************** PP

                     NAM  88 kdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kdke++s+ +g+lvg+kktLvfy+grap+g k++Wvmheyrle
  SapurV1A.0207s0120.1.p 100 KDKEIHSSkTGALVGMKKTLVFYRGRAPEGGKSNWVMHEYRLE 142
                             ******9867888****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-628166IPR003441NAC domain
PROSITE profilePS5100559.81914166IPR003441NAC domain
PfamPF023652.3E-2915141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MESYHHFGDG NTHLPPGFRF HPTDEELITY YLLKKVLDRN FTGRAIAEVD LNKCEPWELP  60
GKAKMVEKEW YFFSLRDRKY PTGLRTNRAT EAGYWKATGK DKEIHSSKTG ALVGMKKTLV  120
FYRGRAPEGG KSNWVMHEYR LEGKLAYHYI SRCSKDEWVI SRVFQKSCGG AAASSGNITK  180
KNRFNTATNL YTEASSPSSV SLPPLLDATA PTATATLYDR DSFSYDSHTQ HEHVSCFSTI  240
AAAAASAAAN SNTNFDLAQL PPPPMTDPFS RFPENTGANC FPSLRSIQEN LQQPFFFASP  300
ASAVAVPPYF HGGVGTATMN WMVNP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-511416717166NAC domain-containing protein 19
4dul_A1e-511416717166NAC domain-containing protein 19
1ut7_B1e-511416717166NO APICAL MERISTEM PROTEIN
1ut7_A1e-511416717166NO APICAL MERISTEM PROTEIN
1ut4_B1e-511416717166NO APICAL MERISTEM PROTEIN
1ut4_A1e-511416717166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006370212.10.0hypothetical protein POPTR_0001s40680g
SwissprotO040171e-112NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLU5GVT20.0U5GVT2_POPTR; Uncharacterized protein
STRINGPOPTR_0001s40680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36893463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.11e-104NAC family protein